PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR01G16340.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 302aa    MW: 33020.8 Da    PI: 6.567
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR01G16340.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.54.8e-161663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde+l++ + ++G g+W+++++  g+ R++k+c++rw +yl
  LPERR01G16340.1 16 RGLWSPEEDEKLYNHIIRYGVGCWSSVPKLAGLERCGKSCRLRWINYL 63
                     788*******************************************97 PP

2Myb_DNA-binding50.16.2e-1669113147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+++++E++l++ ++k lG++ W+ Ia+ ++ gRt++++k++w++ 
  LPERR01G16340.1  69 RGSFSQQEEDLIISLHKILGNR-WSQIASQLP-GRTDNEIKNFWNSC 113
                      899*******************.*********.***********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-23966IPR009057Homeodomain-like
PROSITE profilePS5129417.1571163IPR017930Myb domain
SuperFamilySSF466896.74E-2914110IPR009057Homeodomain-like
SMARTSM007176.8E-131565IPR001005SANT/Myb domain
PfamPF002492.3E-141663IPR001005SANT/Myb domain
CDDcd001678.21E-121963No hitNo description
PROSITE profilePS5129425.50164118IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.7E-2667118IPR009057Homeodomain-like
SMARTSM007171.3E-1568116IPR001005SANT/Myb domain
PfamPF002491.5E-1469113IPR001005SANT/Myb domain
CDDcd001672.40E-1171111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MGREAAASST KAKLRRGLWS PEEDEKLYNH IIRYGVGCWS SVPKLAGLER CGKSCRLRWI  60
NYLRPDLKRG SFSQQEEDLI ISLHKILGNR WSQIASQLPG RTDNEIKNFW NSCLKKKLRQ  120
RGIDPATHKP LNHLADADIT AGPEQQQQQH DDDCFAALAA PHSPAVSFDP LSVTNVQQPS  180
SPYGAVVDVI SDAGMYSGGG GDSSSNSNST AWTCGSVVGI GGGEAAMLAS HMDMFGRDAD  240
APPPYTFDPW QHHHHHEATP PSSHRLDGTA SFPIRSLSRD MPESCFDLGR GGLDDPFGVD  300
FL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-29141185108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1113119LKKKLRQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0925931e-145FP092593.1 Phyllostachys edulis cDNA clone: bphylf046j05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006645979.11e-146PREDICTED: myb-related protein Hv33-like
SwissprotP200271e-77MYB3_HORVU; Myb-related protein Hv33
TrEMBLA0A0D9V1T90.0A0A0D9V1T9_9ORYZ; Uncharacterized protein
STRINGOB01G28670.11e-146(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP111643041
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.16e-74myb domain protein 86